PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ONIVA11G16350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family B3
Protein Properties Length: 419aa    MW: 47184.6 Da    PI: 10.0875
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ONIVA11G16350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B358.21.5e-1832121198
                      EEEE-..-HHHHTT-EE--HHH.HTT.---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..E CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelv 93 
                      ff vl++    ++ r+ +p +f  ++ ++++++  +++l d+sg++W+ +l  +  s+++++  GWkeFv++n ++ g f+vF++d+rs+f   
  ONIVA11G16350.1  32 FFRVLLT--LQSLERMKIPSSFN-QClQNQPTG--MVSLVDRSGNKWSAEL--TSDSEGFFFVHGWKEFVRDNSIQCGQFLVFTYDKRSQF--S 116
                      5666633..4456679******8.564767666..8***************..*********************************99999..8 PP

                      EEEE- CS
               B3  94 vkvfr 98 
                      v+vf+
  ONIVA11G16350.1 117 VTVFE 121
                      88876 PP

2B352.21.1e-16298389398
                      EE-..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
               B3   3 kvltpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                      ++++ s+v     + +p +f++e+   ++++k +tl d++g+ Wev++ y   ++   +++GW +F+  n+L+  D++vF+l+++++   +v++
  ONIVA11G16350.1 298 QIMMESYVYVGFFMNIPCEFVRECL--PRTNKRITLWDPQGKAWEVNYVYYSDRSVGSFSGGWGKFAVGNNLEKFDVCVFELVQKDN--IKVHI 387
                      6789999999**************5..345678***************995555556799*********************998444..57887 PP

                      E- CS
               B3  97 fr 98 
                      +r
  ONIVA11G16350.1 388 YR 389
                      76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd100179.94E-1830120No hitNo description
PROSITE profilePS5086314.77630123IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.106.2E-2131123IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.01E-2231127IPR015300DNA-binding pseudobarrel domain
SMARTSM010198.1E-1532123IPR003340B3 DNA binding domain
PfamPF023621.6E-1639120IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.109.7E-26288389IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019361.7E-25289389IPR015300DNA-binding pseudobarrel domain
CDDcd100171.59E-23294389No hitNo description
SMARTSM010195.0E-15296391IPR003340B3 DNA binding domain
PROSITE profilePS5086313.352296391IPR003340B3 DNA binding domain
PfamPF023627.6E-15298389IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MVVREKQGGR MGKGKGKGKE KEGDINCFGR SFFRVLLTLQ SLERMKIPSS FNQCLQNQPT  60
GMVSLVDRSG NKWSAELTSD SEGFFFVHGW KEFVRDNSIQ CGQFLVFTYD KRSQFSVTVF  120
EPSGIDKIST FSAHPSKNVI IKTESDEGGM VTAAITTEKM APALKENNGI TGKRTRDVDY  180
LMEDRVVVFK KSSEANVCES SRRKRAGASA GKSKVTSTSH NSTRGSSCSS DEDNSSSKSP  240
NPPFLMRFLS GEVSRRGVSK GQRQLTVISQ RRPVTEAEKD HALQRAREFK SKNPFAVQIM  300
MESYVYVGFF MNIPCEFVRE CLPRTNKRIT LWDPQGKAWE VNYVYYSDRS VGSFSGGWGK  360
FAVGNNLEKF DVCVFELVQK DNIKVHIYRV VPEITPHKLR SDPKLSSKYT GLRSENQMV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4i1k_A2e-1326939022142B3 domain-containing transcription factor VRN
4i1k_B2e-1326939022142B3 domain-containing transcription factor VRN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1019410.0AK101941.1 Oryza sativa Japonica Group cDNA clone:J033074I03, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015615373.10.0PREDICTED: B3 domain-containing protein Os11g0197600
SwissprotQ2R9D20.0Y1176_ORYSJ; B3 domain-containing protein Os11g0197600
TrEMBLA0A0E0J3260.0A0A0E0J326_ORYNI; Uncharacterized protein
STRINGBGIOSGA034352-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44613766
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42700.15e-19B3 family protein